File:Beta endorphin AA label.svg
Size of this PNG preview of this SVG file: 800 × 317 pixels. Other resolutions: 320 × 127 pixels | 640 × 253 pixels | 1,024 × 405 pixels | 1,280 × 507 pixels | 2,560 × 1,013 pixels | 2,403 × 951 pixels.
Original file (SVG file, nominally 2,403 × 951 pixels, file size: 216 KB)
 | This is a file from the Wikimedia Commons. Information from its description page there is shown below. Commons is a freely licensed media file repository. You can help. |
Summary
| Description |
English: beta-Endorphin (β-endorphin) is an endogenous opioid neuropeptide and peptide hormone that is produced in certain neurons within the central nervous system and peripheral nervous system. It is one of three endorphins that are produced in humans, the others of which include α-endorphin and γ-endorphin.
SEQUENCE: monogramatic YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE trigramatic Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu |
| Date | |
| Source | Own work |
| Author | Mplanine |
Licensing
I, the copyright holder of this work, hereby publish it under the following license:
This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.
- You are free:
- to share – to copy, distribute and transmit the work
- to remix – to adapt the work
- Under the following conditions:
- attribution – You must give appropriate credit, provide a link to the license, and indicate if changes were made. You may do so in any reasonable manner, but not in any way that suggests the licensor endorses you or your use.
- share alike – If you remix, transform, or build upon the material, you must distribute your contributions under the same or compatible license as the original.
File history
Click on a date/time to view the file as it appeared at that time.
| Date/Time | Thumbnail | Dimensions | User | Comment | |
|---|---|---|---|---|---|
| current | 22:23, 26 January 2023 | | 2,403 × 951 (216 KB) | Mplanine | Uploaded own work with UploadWizard |
File usage
The following page uses this file:
Global file usage
The following other wikis use this file:
- Usage on gl.wikipedia.org
- Usage on zh.wikipedia.org
